PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do026803.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NF-YC
Protein Properties Length: 195aa    MW: 21738.4 Da    PI: 4.7172
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do026803.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC44.53.3e-1422111999
       NF-YC   9 qiekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                 ++e++ +f+nh lP+     i +  +   m+s+++P +l+k  ++fi elt+r+ + a + +r+t+   +i +++++ + + fl d+ pr+
  Do026803.1  22 RLENTVNFNNHILPVL-FAEISRDTKGSFMMSSDTPPVLTKLLDIFIQELTVRASMCATSHDRSTILEPNIYEVINSHESYVFLNDVLPRH 111
                 5799**********96.567888999999***********************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.92E-1048110IPR009072Histone-fold
Gene3DG3DSA:1.10.20.107.2E-1049110IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MDCEQHLCHH CNNKNLMSFG GRLENTVNFN NHILPVLFAE ISRDTKGSFM MSSDTPPVLT  60
KLLDIFIQEL TVRASMCATS HDRSTILEPN IYEVINSHES YVFLNDVLPR HGTNPNRPSM  120
SSNSPQLLQE SLVATSILIE NGPTDPCNKS GEQDFQFSKD NLVPTINAQP NPMELKNEDL  180
NNMSATSSGS IEETK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450581.13e-39hypothetical protein SORBIDRAFT_05g007280
TrEMBLK3ZJT58e-70K3ZJT5_SETIT; Uncharacterized protein
STRINGSi026839m2e-69(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17894510
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56170.22e-10nuclear factor Y, subunit C2